001_Mstar Inc Morningstar Inc. Legal Entity

Senior Software Engineer

Mumbaionsitesenior

Posted yesterday · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Position Title: Senior Software Engineer Team: Indexes Technology, Morningstar India Pvt Ltd The Area The Morningstar Indexes Team leverages its expertise in equity research, manager research, asset allocation, and portfolio construction to create innovative investment solutions. It uses Morningstar’s intellectual property to create indexes that empower investors to achieve their goals at every stage of the investment process—market monitoring, benchmarking, and asset allocation. The fast-growing business offers a broad suite of global equity, bond, commodity and asset allocation indexes.…

Read the full description on 001_Mstar Inc Morningstar Inc. Legal Entity's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, java, sql, flask, fastapi…

Level fit

This role is senior-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Mumbai. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavasqlflaskfastapispringspring bootrestpostgresqlrdsauroraawss3lambdaecsiamdockerjenkinskafkamodepandasnumpyclaudegithub

More at 001_Mstar Inc Morningstar Inc. Legal Entity

See all open jobs at 001_Mstar Inc Morningstar Inc. Legal Entity →