A
AmazonSupply Chain Management

Senior Planner, Network Planning, JP Trans LTP Network Planning

JPonsitesenior

Posted today · via Amazon

About this role

Join Amazon Japan's Dynamic Transportation Team! We're seeking a talented Planner to join JP Transportation, the core division driving Amazon Japan's transportation network. In this role at the heart of Amazon operations, you'll develop short to long-term transportation plans (next 3 weeks to up to next 3 years), using in-house tools and data analytics to optimize our rapidly growing network. This role offers the opportunity to impact millions of customers through one of the world's largest logistics operations. This role offers opportunities to combine strong analytical skills with managing ambiguity in a fast-paced environment, while driving the development of Amazon's gigantic supply chain network.…

Read the full description on Amazon's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, java, ruby, php, c#…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in JP. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavarubyphpc#perlpowershellsqlmysqlredshiftchefteams

More at Amazon

See all open jobs at Amazon