Senior Planner, Network Planning, JP Trans LTP Network Planning
JPonsitesenior
Posted today · via Amazon
About this role
Join Amazon Japan's Dynamic Transportation Team! We're seeking a talented Planner to join JP Transportation, the core division driving Amazon Japan's transportation network. In this role at the heart of Amazon operations, you'll develop short to long-term transportation plans (next 3 weeks to up to next 3 years), using in-house tools and data analytics to optimize our rapidly growing network. This role offers the opportunity to impact millions of customers through one of the world's largest logistics operations. This role offers opportunities to combine strong analytical skills with managing ambiguity in a fast-paced environment, while driving the development of Amazon's gigantic supply chain network.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, ruby, php, c#…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in JP. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavarubyphpc#perlpowershellsqlmysqlredshiftchefteams
More at Amazon
- View →QAE II, Lending, Amazon India PaymentsIN, KA, Bengaluru
- View →IT Support Associate II, OTSUS, AZ, Phoenix
- View →Sr. Program Manager- ACES, IN AMZLIN, KA, Bengaluru
- View →Capacity Planning Manager, Amazon Japan Last Mile Capacity PlanningJP, 13, Tokyo
- View →Software Development Manager, AI StudiosUS, CA, Culver City
- View →IT Support Associate II, OTSUS, AZ, Goodyear
