Senior Software Engineer -Data Platform (Batch Processing & Data Security)

APAC - India - Bengaluru - Sunriveronsitesenior$10K$17K

Posted yesterday · via Workday

About this role

Job Requisition ID # 26WD96382 Position Overview We are looking for a Senior Software Engineer to join our Data Platform team, focusing on Batch Processing and Data Security/Governance. This role is critical in building scalable,reliable, and secure data pipelines that power enterprise-wide analytics, machine learning, and business decision-making. You will work on designing and operating large-scale data platforms using modern lakehouse architectures, ensuring high data quality, observability, and compliance with security and governance standards Responsibilities Contribute to the team’s vision and articulate strategies to have fundamental impact at our massive scale You will need a product-focused mindset.…

Read the full description on Autodesk's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, java, scala, sql, aws…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in APAC - India - Bengaluru - Sunriver. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavascalasqlawsiamsparkkafkaflinkairflow

More at Autodesk

See all open jobs at Autodesk