B
BeyondoneTechnology

Technology Operation Engineer

Riyadhonsitemid

via Greenhouse

About this role

We don’t think about job roles in a traditional way. We are anti-silo. Anti-career stagnation. Anti-conventional. Beyond ONE is a digital services provider radically reshaping the personalised digital ecosystems of consumers in high growth markets around the world. We’re building a digital services aggregator platform, with a strong telco foundation, and a profitable growth strategy that empowers users to drive their own experience—subscribe once, source from many, and only pay for what you actually use. Since being founded in 2021, we’ve acquired Virgin Mobile MEA, Friendi Mobile MEA and Virgin Mobile LATAM (with 6.5 million subscribers) and 1600 dedicated colleagues across Chile, Colombia, KSA, Kuwait, Mexico, Oman, Pakistan and UAE.…

Read the full description on Beyondone's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, shell, rest, soap, mysql…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Riyadh. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonshellrestsoapmysqlgrafanaelkkafkateamsgreenhouse

More at Beyondone

See all open jobs at Beyondone