Staff Data Engineer - Governance
Remote - Brazilremotestaff
via Greenhouse
About this role
About the Role At Blip, data is more than a byproduct, it's a strategic asset. Our Data Platform powers everything from internal decision-making to the next generation of AI-driven experiences. We're now looking for a Sr. Staff Data/Platform Engineer to play a foundational role in scaling and evolving this platform. This role is ideal for someone who is passionate about solving deep engineering challenges, working across large-scale distributed systems, and translating real-time data into meaningful intelligence across the company.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, scala, sql, spark…
2
Level fit
This role is staff-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavascalasqlsparkkafkaflinkteams
More at Blip Global
- View →Sales Development RepresentativeMexico City
- View →Consumer & Market Insights SpecialistSão Paulo, SP
- View →Senior Inside SalesSão Paulo
- View →Data Engineer Revenue OperationsMadrid, Spain
- View →Coordenador de Aquisição | BDR + Inside SalesBelo Horizonte
- View →Growth & Paid Media Sr AnalystMéxico City