Data Scientist
Charlestononsitemid
Posted 3w ago · via Workday
About this role
Location Charleston - 997 Morrison Drive, Suite 402 Business Our Growth, Your Opportunity At Maymont Homes, our success starts with people, our residents and our team. We are transforming the single-family rental experience through innovation, quality, and genuine care. With more than 20,000 homes across 47+ markets, 25+ build-to-rent communities, and continued expansion on the horizon, we are more than a leader in the industry—we are a company that puts people and communities at the heart of everything we do. As part of Brookfield, Maymont Homes is growing quickly and making a lasting impact. We are also proud to be Certified™ by Great Place to Work®, a recognition based entirely on feedback from our employees.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, aws, pandas, scikit-learn…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Charleston. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlawspandasscikit-learngitteams
More at Brookfield
- View →Residential Market SpecialistCharlotte, North Carolina
- View →Residential Market SpecialistDallas, Texas
- View →Leasing Ambassador (Build to Rent) Part TimeDawsonville, Georgia
- View →Leasing Ambassador (Build to Rent)Tampa, Florida
- View →Technical Support EngineerCharleston, South Carolina
- View →Community Manager - Build to RentCincinnati, Ohio
