Data Scientist

Charlestononsitemid

Posted 3w ago · via Workday

About this role

Location Charleston - 997 Morrison Drive, Suite 402 Business Our Growth, Your Opportunity At Maymont Homes, our success starts with people, our residents and our team. We are transforming the single-family rental experience through innovation, quality, and genuine care. With more than 20,000 homes across 47+ markets, 25+ build-to-rent communities, and continued expansion on the horizon, we are more than a leader in the industry—we are a company that puts people and communities at the heart of everything we do. As part of Brookfield, Maymont Homes is growing quickly and making a lasting impact. We are also proud to be Certified™ by Great Place to Work®, a recognition based entirely on feedback from our employees.…

Read the full description on Brookfield's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, sql, aws, pandas, scikit-learn…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Charleston. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonsqlawspandasscikit-learngitteams

More at Brookfield

See all open jobs at Brookfield