C
CoherehealthMachine Learning and Data Science

Staff Data Scientist

Hyderabadonsitestaff$46K$420K

via Greenhouse

About this role

Opportunity Overview: As a Staff Data Scientist at Cohere Health, you will serve as a technical leader across high-priority initiatives, shaping how data science is applied to some of the most complex challenges in healthcare. You’ll drive the design of advanced analytical and modeling solutions, influence strategic direction, and partner deeply across Product, Clinical, and Engineering to deliver scalable, high-impact outcomes. This role goes beyond execution. You’ll define approaches, set standards, and guide others in solving ambiguous, high-leverage problems. You’ll play a critical role in advancing the maturity of data science at Cohere while contributing directly to improving clinical and operational decision-making. What you’ll do:…

Read the full description on Coherehealth's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, elasticsearch, aws, emr, spark…

2

Level fit

This role is staff-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Hyderabad. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonelasticsearchawsemrsparkpysparktransformerscohereteams

More at Coherehealth

See all open jobs at Coherehealth