Development Engineer 4
India - Chennaionsitemid
Posted today · via Workday
About this role
Comcast brings together the best in media and technology. We drive innovation to create the world's best entertainment and online experiences. As a Fortune 50 leader, we set the pace in a variety of innovative and fascinating businesses and create career opportunities across a wide range of locations and disciplines. We are at the forefront of change and move at an amazing pace, thanks to our remarkable people, who bring cutting-edge products and services to life for millions of customers every day. If you share in our passion for teamwork, our vision to revolutionize industries and our goal to lead the future in media and technology, we want you to fast-forward your career at Comcast.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, sql, databricks, aws…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in India - Chennai. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavasqldatabricksawssparkpysparkhivekafkaairflowteams
More at Comcast
- View →Xfinity Mobile Retail Service AssociateIL - Wheaton, 1 Rice Lake Square - Retail XFR1338
- View →Xfinity Mobile Retail Service AssociateIL - Naperville, 2727 W. 75th Street - Retail XFR1335
- View →Sr. Product Manager, Streaming Operations-XumoCA - Irvine, 5300 California Ave., 4th floor
- View →Xfinity Retail Store ManagerIN - Granger, 7115 Heritage Square Dr - Retail XFR1712
- View →Xfinity Retail Store ManagerIL - Morton Grove, 7927 Golf Rd - Retail XFR1302
- View →Engineer 2, Development EngineerIndia - Chennai, Comcast India Engineering Cent
