Software Engineer, Observability
Warsawonsitemid
via Greenhouse
About this role
CoreWeave is The Essential Cloud for AI™. Built for pioneers by pioneers, CoreWeave delivers a platform of technology, tools, and teams that enables innovators to build and scale AI with confidence. Trusted by leading AI labs, startups, and global enterprises, CoreWeave combines superior infrastructure performance with deep technical expertise to accelerate breakthroughs and turn compute into capability. Founded in 2017, CoreWeave became a publicly traded company (Nasdaq: CRWV) in March 2025. Learn more at www.coreweave.com . We're proud to be a Living Wage accredited Employer.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, go, elasticsearch, clickhouse, kubernetes…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Warsaw. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythongoelasticsearchclickhousekuberneteshelmgrafanaprometheuslokiopentelemetrykafkateamsgdprgreenhouse
More at Core Weaveu
- View →Senior Manager, Field EngineeringLondon, UK
- View →Senior Counsel, CommercialLondon, England
- View →Staff Software Engineer, Cluster Orch (SUNK)Warsaw, Poland
- View →Director, European ControllerLondon, UK/Europe
- View →Inventory Control Specialist - Blonduos, IcelandEurope
- View →Solution Specialist, InfrastructureLondon, UK
