Senior Software Development Manager - ECommerce Engineering
Bengaluruonsitemanager$21K – $27K
via Greenhouse
About this role
Company Introduction :
We exist to wow our customers. We know we’re doing the right thing when we hear our customers say, “How did we ever live without Coupang?” Born out of an obsession to make shopping, eating, and living easier than ever, we’re collectively disrupting the multi-billion-dollar e-commerce industry from the ground up. We are one of the fastest-growing e-commerce companies that established an unparalleled reputation for being a dominant and reliable force in South Korean commerce.
We are proud to have the best of both worlds — a startup culture with the resources of a large global public company. This fuels us to continue our growth and launch new services at the speed we have been since our inception.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: mysql, redis, redshift, spark, kafka…
2
Level fit
This role is manager-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Bengaluru. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
mysqlredisredshiftsparkkafkaairflowteams
More at Coupang
- View →[쿠팡] 쿠팡이츠 파트너쉽 영업 기획 담당자Seoul, South Korea
- View →[쿠팡페이] BX DesignerSeoul, South Korea
- View →[쿠팡로지스틱스서비스] 서브허브 물류 자동화 설비보전 엔지니어 (인재풀 등록)z-Test & Templates Only
- View →쿠팡풀필먼트서비스 인재풀 등록 (자동화 설비분야)z-Test & Templates Only
- View →쿠팡로지스틱스서비스 인재풀 등록 (물류운영 분야)Seoul, South Korea
- View →Senior SourcerTokyo, Japan
