Systems Engineer (DevOps) - multiple levels - FULLY CLEARED with POLYGRAPH REQUIRED
Columbiaonsitemid
Posted 11mo ago · via Lever
About this role
RHEL 617/8, RHCSNRHCE CentOS, Confluence / Jira, Python, Ruby, Perl, Java, DevOps, Site Reliability Engineering, Software Defined Networking, deployment architecture, SLA requirements, Configuration Management, containerization, serverless technologies, Kubernetes, Gradle, Maven, ANT, Shell, Jenkins, Docker, Bamboo, Amazon Web Services, VMWare, Puppet, Chef, ansible, Memcache, Active MQ, Redis, APC, MySQL (Clusters, Replication, and Tuning), Elasticsearch, Kibana
Due to federal contract requirements, United States citizenship and an active TS/SCI security clearance and polygraph are required for the position.
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, ruby, perl, shell…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Columbia. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavarubyperlshellmysqlrediselasticsearchkubernetesdockeransiblepuppetchefserverlessjenkinsjiraconfluencegradlemaven
More at Cti Md
- View →Database Administrator - FULLY CLEARED with POLYGRAPH REQUIREDSan Antonio, TX
- View →Software Engineer - Junior - FULLY CLEARED with POLYGRAPH REQUIREDFort Meade, MD
- View →Systems Integration Engineer - FULLY CLEARED with POLYGRAPH REQUIREDFort Meade, MD
- View →Software Engineer (Analytic Developer) - FULLY CLEARED with POLYGRAPH REQUIREDAnnapolis Junction, MD
- View →Software Engineer - Principal - FULLY CLEARED with POLYGRAPH REQUIREDFort Meade, MD
- View →Information Systems Security Officer (ISSO) - Level 02 - FULLY CLEARED with POLYGRAPH REQUIREDFort Meade, MD
