DatsolutionsProd/Tech - Identity (DAT338)

Software Engineer - IAM Team

Bengaluruonsitemid

via Greenhouse

See if I'm a fit →Tailor my resume for this role →Apply on Greenhouse ↗

About this role

Software Engineer - IAM Team Software Engineer [P2] Job Description: Software Engineer - Full Stack (BE Primary) Role: Software Engineer - Account Management & Customer Support Location: Bangalore, India DAT is looking for a self-driven, passionate, and experienced Software Engineer to join our Account Management & Customer Support domain team within our Identity & Access Management (IAM) umbrella in Bangalore, India. At DAT, our leaders optimistically share future possibilities to inspire and motivate others toward their full potential. We expect our employees to find ways to embrace positive change, be curious, challenge the status quo, and provide solutions to unmet problems.…

Read the full description on Datsolutions's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: typescript, javascript, java, angular, node.js…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Bengaluru. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptjavascriptjavaangularnode.jsgraphqlpostgresqlmysqlawsgcpfargateiamkubernetesdockerterraformserverlesskafkaclaudegithubteams

More at Datsolutions

See all open jobs at Datsolutions →