Software Engineer - Clearance Jobs
Fieldonsitemid
via Greenhouse
About this role
This Is the Place to Be:
Connecting Futures Now! DHI Group, Inc. is the parent company of career marketplaces, Dice and ClearanceJobs. We connect candidates with career advice, resources and ultimately a dream job. At DHI, we’ve built a workplace where great people do meaningful work. This is the place to be, and we want you here with us.
You Belong Here:
Join a mission-driven company that puts its people first. We’re a collaborative, supportive team that lives by our “One Team” value – working together and winning together. Voted as a certified Great Place to Work®, our team members feel their opinions count and are cared for by DHI. 92% of employees say DHI is a Great Place to Work – 35% higher than the average U.S. company.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, php, sql, laravel, graphql…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Field. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptphpsqllaravelgraphqlrestwebsocketmysqlrdsawscloudfronts3ec2lambdadockerterraformclaudemodalgitoauth
More at Dhigroupinc
- View →Client Success Partner - DICE MMDes Moines, IA
- View →Senior Software EngineerDenver, CO; Field
- View →Software Engineer AIDenver, CO
- View →Client Success Partner - MidMarket - ClearanceJobsDes Moines, IA
- View →Associate Client Success PartnerDes Moines, IA
- View →Software Engineer - DiceDenver, CO; Des Moines, IA; Field
