Platform Content Specialist - Salesforce Marketing Cloud

Netherlands - Amsterdam Officeonsitemid

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

As a Platform Specialist with an emphasis on Salesforce Marketing Cloud (SFMC), you will report into the SFMC Platform Lead. You are expected to be at the forefront of the platform for the team which includes requesting enhancements to improve owner experience, being up to date with all functionality, creating guides on how to use Dyson systems effectively, and being accountable for training the platforms to others within Group and in market teams. You are also expected to manage delivery and activation of content for NPD & campaigns, improvements to existing content, and being a key stakeholder in enhancements to our digital platforms which improve anything from end user experience to back end content management build processes.…

Read the full description on Dyson Operations Pte's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, sql, html, css, teams…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Netherlands - Amsterdam Office. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptsqlhtmlcssteamssalesforce

More at Dyson Operations Pte

See all open jobs at Dyson Operations Pte →