Mobile Engineer Intern (iOS)
Mountain Viewonsitejunior
via Greenhouse
About this role
About EarnIn
As one of the first pioneers of earned wage access, our passion at EarnIn is building products that deliver real-time financial flexibility for those with the unique needs of living paycheck to paycheck. Our community members access their earnings as they earn them, with options to spend, save, and grow their money without mandatory fees, interest rates, or credit checks.
We’re fortunate to have an incredibly experienced leadership team, combined with world-class funding partners like A16Z, Matrix Partners, DST, Ribbit Capital, and a very healthy core business with a tremendous runway. We’re growing fast and are excited to continue bringing world-class talent onboard to help shape the next chapter of our growth journey.
POSITION SUMMARY…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, swift, html, css, react…
2
Level fit
This role is junior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Mountain View. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptswifthtmlcssreactteams
More at Earnin
- View →Senior Business Systems AnalystMexico City, Mexico; Remote, Mexico
- View →SiteOps SpecialistMexico City, Mexico
- View →Staff Analytics, Product & MarketingMountain View, US
- View →Senior Lifecycle Marketing ManagerMexico City, Mexico
- View →Future Opportunities at EarnInMountain View, US
- View →Office & Facilities ManagerMountain View, US
