E
ElementalledincMarketing

Web Content Specialist

Renoonsitemid

Posted 3 days ago · via Smartrecruiters

About this role

About The Opportunity: Elemental LED is a leading U.S. based engineering and technology company that creates, develops, manufactures, markets and sells innovative, configured and integrated LED lighting solutions. The Economic Development Authority of Western Nevada (EDAWN) has awarded Elemental LED as the "Company of the Year-Large" at the 7th Annual EDAWN Existing Awards event and "Employees First - Large" at the 10th Annual EDAWN Existing Industry Awards event. Are you ready to help drive a massive digital evolution? We are seeking a passionate and detail-oriented Web Content Specialist to join our Marketing team and partner with our Web Content Manager to shape the future of our online presence.…

Read the full description on Elementalledinc's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, html, css, mysql…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Reno. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphphtmlcssmysqlawsfigmasketchadobe xdteamsgdpr

More at Elementalledinc

See all open jobs at Elementalledinc