Senior Machine Learning Data Scientist
RemoteRemote (US)senior$135K – $165K
via Greenhouse
About this role
About Extend:
Extend is revolutionizing the post-purchase experience for retailers and their customers by providing merchants with AI-driven solutions that enhance customer satisfaction and drive revenue growth. Our comprehensive platform offers automated customer service handling, seamless returns/exchange management, end-to-end automated fulfillment, and product protection and shipping protection alongside Extend's best-in-class fraud detection. By integrating leading-edge technology with exceptional customer service, Extend empowers businesses to build trust and loyalty among consumers while reducing costs and increasing profits.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, aws, sagemaker, scikit-learn…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlawssagemakerscikit-learnpytorchteams
More at Extend
- View →Account Manager, Enterprise Growth StrategySan Francisco, CA
- View →Account Executive, Corporate EnterpriseSan Francisco, CA
- View →Claims Adjudication Specialist (Tier I)Remote, US
- View →Fraud Operations Specialist IRemote, US
- View →Lead Risk Analytics Data ScientistRemote, US
- View →Senior Software Engineer IIRemote, US
