Senior Application Manager

Badenonsitemanager

Posted today · via Workday

About this role

Who are we? At Finastra, we’re a global leader in financial services software, dedicated to expanding access to financial services and shaping what’s next for the industry. Our technology powers mission‑critical solutions across Lending, Payments and Universal Banking, supporting over 7,000 customers, including 80% of the world’s top 50 banks, in more than 110 countries. As part of our Application Management Team based in Baden, Switzerland, we are looking for a motivated and self-directed Technical Application Manager who is excited to work in a dynamic team and be part of a successful, multicultural organization.…

Read the full description on Finastra's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: java, swift, shell, sql, sass…

2

Level fit

This role is manager-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Baden. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javaswiftshellsqlsassrailsrestpostgresqlansiblepuppetjirateams

More at Finastra

See all open jobs at Finastra