Focusit RecruitmentInformation Technology

Web Developer

Swanseaonsitemid

Posted 82mo ago · via Smartrecruiters

See if I'm a fit →Tailor my resume for this role →Apply on Smartrecruiters ↗

About this role

Web Developer The Company: Focus IT are pleased to assist this Nationwide company who offer services for their clients across the globe. The Role: Due to industry growth we now have a requirement for a hardworking software developer working with Laravel and Vue.js. Key responsibilities: · Design and develop some exiting websites · Cross talented developer, Maintenance, enhancements and new development The Candidate: The candidate will need to be highly resourceful and an innovative developer. With are looking for someone with a key eye for design, layout and strong knowledge of coding websites. Key skills are as follows: · PHP 7+ · Laravel – Proficiency · JavaScript ES6+ · Vuejs – Proficiency · AWS/Server knowledge · Sketch · HTML · SQL Database Web Developer

Read the full description on Focusit Recruitment's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, php, sql, html, laravel…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Swansea. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphpsqlhtmllaravelsketch

More at Focusit Recruitment

See all open jobs at Focusit Recruitment →