Web Developer
Swanseaonsitemid
Posted 82mo ago · via Smartrecruiters
About this role
Web Developer The Company: Focus IT are pleased to assist this Nationwide company who offer services for their clients across the globe. The Role: Due to industry growth we now have a requirement for a hardworking software developer working with Laravel and Vue.js. Key responsibilities: · Design and develop some exiting websites · Cross talented developer, Maintenance, enhancements and new development The Candidate: The candidate will need to be highly resourceful and an innovative developer. With are looking for someone with a key eye for design, layout and strong knowledge of coding websites. Key skills are as follows: · PHP 7+ · Laravel – Proficiency · JavaScript ES6+ · Vuejs – Proficiency · AWS/Server knowledge · Sketch · HTML · SQL Database Web Developer
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, php, sql, html, laravel…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Swansea. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptphpsqlhtmllaravelsketch
More at Focusitrecruitment
- View →Junior IT Support TechnicianMilton Keynes, , United Kingdom
- View →2nd Line Support EngineerNewport Pagnell, , United Kingdom
- View →PPC ManagerSouth East London, , United Kingdom
- View →Software DeveloperMilton Keynes, , United Kingdom
- View →.NET DeveloperThame, , United Kingdom
- View →Senior Recruitment ConsultantMilton Keynes, , United Kingdom
