F
ForterEngineering

Senior Full Stack Engineer II - CX Offering

Israel - Tel Avivonsitesenior

via Greenhouse

About this role

About the Role Forter seeks a highly skilled, motivated Senior Full-Stack Engineer II to join the Customer Experience Offerings (CXO) team. This team delivers and scales Forter's core offerings and agentic experiences, creating smart automation for customers to confidently understand, configure, and optimize their journey. Part of the Customer Experience group, this high-impact, hands-on role involves working across the full application stack - backend (Node.js, TypeScript), frontend (React, Next.js) and data pipelines. The ideal candidate has deep expertise in fullstack development, large-scale data stores, data models, and high-throughput infrastructure.…

Read the full description on Forter's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, react, next.js, node.js, mysql…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Israel - Tel Aviv. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptreactnext.jsnode.jsmysqlrediselasticsearchawssqskafkaclaudegithubteamssalesforcesequoia

More at Forter

See all open jobs at Forter