Senior Full Stack Engineer II - CX Offering
Israel - Tel Avivonsitesenior
via Greenhouse
About this role
About the Role
Forter seeks a highly skilled, motivated Senior Full-Stack Engineer II to join the Customer Experience Offerings (CXO) team. This team delivers and scales Forter's core offerings and agentic experiences, creating smart automation for customers to confidently understand, configure, and optimize their journey.
Part of the Customer Experience group, this high-impact, hands-on role involves working across the full application stack - backend (Node.js, TypeScript), frontend (React, Next.js) and data pipelines. The ideal candidate has deep expertise in fullstack development, large-scale data stores, data models, and high-throughput infrastructure.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, react, next.js, node.js, mysql…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Israel - Tel Aviv. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptreactnext.jsnode.jsmysqlrediselasticsearchawssqskafkaclaudegithubteamssalesforcesequoia
More at Forter
- View →Senior Software AI EngineerUnited Kingdom - London
- View →Senior Software Engineer , AIIsrael - Tel Aviv
- View →General Application (Israel)Israel - Tel Aviv
- View →Product Marketing ManagerUnited States - New York
- View →Senior Software Engineer II, PaymentsIsrael - Tel Aviv
- View →Enterprise Account ExecutiveUnited Kingdom - London
