Software Engineer, Trust & Safety
mid
via Ashby
About this role
WHY THIS ROLE MATTERS NOW
AI has dramatically lowered the barrier for bad actors. Generating convincing phishing pages, spinning up realistic-looking fraudulent accounts, and producing abusive content at scale no longer requires specialized skill—a motivated attacker with access to widely available models can do it. The volume and sophistication of platform abuse is increasing faster than traditional approaches can keep up with.
At the same time, AI is transforming what's possible on the defensive side. A small, sharp T&S team equipped with frontier models can now build detection, triage, and response systems that would have required a team five times the size just a couple of years ago.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, graphql, redis, prisma, aws…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in a specific location. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptgraphqlredisprismaawskafkateamsapollo