reqspace
Start free trial →
G
Gdit

Drupal Developer - Remote Role

Any Location / Remoteremotemid$94K – $127K

Posted yesterday · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Type of Requisition: Regular Clearance Level Must Currently Possess: None Clearance Level Must Be Able to Obtain: None Public Trust/Other Required: None Job Family: Software Engineering Job Qualifications: Skills: Drupal, Hyper Text Markup Language (HTML), PHP (Programming Language), Software Development, Web Applications Certifications: None Experience: 2 + years of related experience US Citizenship Required: No Job Description: We are GDIT. As one of the largest IT and mission services providers to the government, we own our opportunities to better enable healthcare organizations to identify theirs. Shape what’s next for mission-critical government projects while shaping what’s next for your engineering career. Join GDIT as a Drupal Developer.…

Read the full description on Gdit's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, html, css, less…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphphtmlcsslessmysqlawsazureconfluence

More at Gdit

See all open jobs at Gdit →