Senior Feature Engineer

Remote - United StatesRemote (US)senior

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Job Description The Role: General Motors is seeking a highly motivated and qualified candidate for the position of Senior Feature Engineer on our Data & Feature Engineering team. This team builds the shared feature store, governance model, and platform tooling that power advanced analytics and machine learning solutions aimed at improving product reliability and performance. As a Senior Feature Engineer, you will lead the design, development, and operation of our governed feature platform, the shared infrastructure, standards, and tooling that domain teams use to define, certify, and serve reusable features for product analytics.…

Read the full description on General Motors's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, sql, databricks, spark, pyspark…

Level fit

This role is senior-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonsqldatabrickssparkpysparkkafkapandasgitteams

More at General Motors

See all open jobs at General Motors →