Senior Data Engineer - (Real-Time Streaming)

Chennaionsitesenior

Posted yesterday · via Workable

See if I'm a fit →Tailor my resume for this role →Apply on Workable ↗

About this role

We are looking for an experienced Senior Data Engineer with strong expertise in Real-Time Streaming, Java, Apache Kafka, Apache Flink, and PySpark to build and operate high-performance, scalable streaming data platforms supporting enterprise Business Platforms and Risk & Compliance initiatives. The ideal candidate will have extensive experience designing and implementing real-time data pipelines, event-driven architectures, and distributed data processing systems capable of handling high-volume, low-latency data workloads. This role requires strong engineering expertise in modern data platforms, stream processing, and Big Data technologies while collaborating closely with architects, platform teams, and business stakeholders.…

Read the full description on GSS Tech Group's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, java, sql, spark, pyspark…

Level fit

This role is senior-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Chennai. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavasqlsparkpysparkkafkaflinkgitteams

More at GSS Tech Group

See all open jobs at GSS Tech Group →