Tech Lead, Ad Exchange
Santa Monicaonsitesenior$186K – $215K
via Greenhouse
About this role
GumGum is The Mindset Company™ transforming advertising. We’re an advertising technology company delivering results by matching brands with people in the right mindset in the moments that matter. Our platform is powered by the Mindset Graph™, our AI-driven data engine that processes billions of real-time contextual, creative, environmental, and historical signals to match every ad with the most receptive audience. The result is advertising that drives meaningful outcomes for advertisers and publishers, and is more relevant for consumers.
We were founded in 2008 and are headquartered in Santa Monica, California, operating in over 19 markets across North America, Europe, Japan, and Australia.
Our principles guide our work every day and are as follows:…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: java, spring, mysql, memcached, aws…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Santa Monica. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javaspringmysqlmemcachedawskafkajirateams
More at Gumgum
- View →VP Sales Strategy & OperationsNew York, United States
- View →Account Manager (digital media/advertising)Sydney, New South Wales, Australia
- View →Legal Operations ManagerSanta Monica, California, United States
- View →Sales DirectorBoston, Massachusetts, United States
- View →Group Digital Director (Group Sales Director)London, England, United Kingdom
- View →Digital ManagerManchester, England, United Kingdom
