Webdesigner (m/w/d)
Neutraublingonsite
via Personio
About this role
Dein Aufgabenbereich Entwicklung und Umsetzung von kreativen Designkonzepten in Bezug auf Webseiten Gestaltung von Print- und Digitalmedien (Broschüren, Flyer, Webseiten, Social Media Grafiken) Bildbearbeitung und Retusche Erstellung von Logos Einhaltung des bestehenden Corporate Designs unserer Kunden Zusammenarbeit mit dem Marketingteam Kundenkontakt Deine Kompetenzen Hohe Affinität zu Künstlicher Intelligenz (KI): Interesse an neuen Technologien und die Fähigkeit, KI-Tools effizient in Arbeitsprozesse zu integrieren. Ausgeprägte Macher-Mentalität: Proaktives Handeln, Eigeninitiative und Umsetzungsstärke – von der Idee bis zum fertigen Ergebnis. Kenntnisse in Figma: Sicherer Umgang mit Figma zur Erstellung und Bearbeitung von modernen UI/UX-Designs.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, r, html, css, react…
2
Level fit
We check your title trajectory against the seniority signal of the role.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Neutraubling. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptrhtmlcssreacttailwindfigma
More at HRF GmbH & Co. KG
- View →Ausbildung Kaufmann für Büromanagement (m/w/d)Minden
- View →Software Projektmanager / Scrum Master (m/w/d)Minden
- View →Node.js Developer goes AI (m/w/d)Minden
- View →Initiativbewerbung Softwareentwickler (m/w/d)Minden
- View →Software Product Owner (m/w/d)Minden
- View →Ausbildung Kaufmann für IT-System-Management (m/w/d)Neutraubling
