I
Iliad FreeTech & Digital

Staff Engineer Python - Paris - H/F

Parisonsitestaff

Posted 6mo ago · via Smartrecruiters

About this role

About Chez Free, tu trouveras unea0 culture interne singulière a0et très marquée. Il règne un fort état d’esprit collectif. Le recrutement est ouvert, sans a priori : on ne juge les gens ni sur leur âge, ni sur leur background. On aime aller vite, faire les choses nous-mêmes, et on mise sur l’autonomie pour être efficace.…

Read the full description on Iliad Free's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, r, sql, react, vite…

2

Level fit

This role is staff-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Paris. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonrsqlreactvitefastapisqlalchemykubernetesdockergrafanakafka

More at Iliad Free

See all open jobs at Iliad Free