reqspace
Start free trial →
I
Informa Group PlcInforma TechTarget

Director of Software Engineering

Georgetownhybriddirector

Posted 2 days ago · via Smartrecruiters

See if I'm a fit →Tailor my resume for this role →Apply on Smartrecruiters ↗

About this role

About About Omdia Omdia, part of Informa TechTarget, Inc. (Nasdaq: TTGT), is a leading technology research and advisory group. With deep expertise in technology markets, grounded in insightful conversations with industry leaders and supported by hundreds of thousands of data points, Omdia's strategic market intelligence is our clients' competitive advantage. With over 300 analysts and consultants covering more than 200 technology markets across 25 global research locations, Omdia delivers the market intelligence executives rely on to drive strategy, validate investments and outpace competitors. Our team delivers deep, actionable insight across sectors like AI, cybersecurity, channel, semiconductors, telecoms, consumer tech, and more.…

Read the full description on Informa Group Plc's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, java, r, sql, .net…

2

Level fit

This role is director-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Georgetown. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavarsql.netredisredshiftawsgcpcloudflareiamserverlesstableaupower bilangchaingeminibedrockgithubteamssalesforce

More at Informa Group Plc

See all open jobs at Informa Group Plc →