J
JumpfactorWeb Development

Senior WordPress Developer (Remote)

Torontoremotesenior

Posted 2mo ago · via Recruitee

About this role

About Jumpfactor 8-time Growth500 agency driving $1.6B+ in MSP and B2B tech revenue. Fast-paced, performance-driven, and built for high-quality digital execution. The Role Build, maintain, and optimize WordPress websites by translating designs into scalable, responsive, and high-performance builds with custom functionality and integrations.…

Read the full description on Jumpfactor's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, html, css, mysql…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphphtmlcssmysqlawsgitteamshubspot

More at Jumpfactor

See all open jobs at Jumpfactor