Senior Software Engineer - Backend Legal Pros Academico
Remotoonsitesenior
via Greenhouse
About this role
Você deveria fazer parte do Jusbrasil
Transformar o sistema de Justiça com tecnologia não é trivial. Estamos construindo uma inteligência artificial dentro de casa: o Jus IA tem 43% menos alucinações que IAs generalistas. Essa é a prova concreta de que aqui tecnologia não é discurso, e sustenta a nossa missão: elevar a justiça.
Lidamos com mais de 7 bilhões de documentos jurídicos e mais de 1.400 fontes de dados oficiais. É desafio de escala e precisão que poucas empresas no país enfrentam.
Somos 670 pessoas jusbrasileiras, quase metade em engenharia e produto, espalhadas por mais de 125 cidades no Brasil e fora. O modelo é remoto: você escolhe onde viver, a vaga não muda.
Aqui, quem chama pra si o problema sem dono e entrega algo acima do esperado cresce rápido.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, go, r, rest, postgresql…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Remoto. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythongorrestpostgresqlelasticsearchawsgcpkafkarabbitmq
More at Jusbrasil
- View →Analista de Qualidade Jurídica Júnior [Vaga Afirmativa para PCD]Brasil
- View →SRE Partner [Vaga Afirmativa para PCD]Remoto
- View →Analytics Engineer [Vaga Afirmativa para PCD]Remoto
- View →Senior Analytics EngineerBrasil
- View →Senior Data EngineerBrasil
- View →Senior Data Engineer [Vaga Afirmativa para PCD]Remoto
