J
JusbrasilEngenharia

Senior Software Engineer - Backend Legal Pros Academico

Remotoonsitesenior

via Greenhouse

About this role

Sobre o Jusbrasil Transformar o sistema de Justiça com tecnologia não é um desafio trivial. Por isso, o Jusbrasil se posiciona como uma empresa AI-first, que utiliza IA Generativa, dados massivos e engenharia de ponta para resolver problemas complexos e criar impacto real em escala. Estamos vivendo um ponto de virada: a revolução da GenAI está redefinindo o mercado, e temos nas mãos uma oportunidade rara de liderar a transformação tecnológica do sistema jurídico no Brasil. Lidamos com petabytes de dados, bilhões de documentos e desafios de escala, precisão e relevância dignos das maiores techs do mundo. Nosso time opera com alta densidade de talentos, autonomia e propósito.…

Read the full description on Jusbrasil's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, go, rest, postgresql, elasticsearch…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Remoto. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythongorestpostgresqlelasticsearchawsgcpkafkarabbitmq

More at Jusbrasil

See all open jobs at Jusbrasil