PHP/WordPress Engineer
Europeonsitemid
via Greenhouse
About this role
We are inviting you, a highly motivated and results-oriented PHP/WordPress Engineer to join our team for ensuring solutions, as well as strengthening the product.
Our team has unique expertise in research, analysis, and product development. By relying on technical insights and a data-driven approach, we create disruptive future-defining innovations of the fin-tech industry that remain our basis for success.
Responsibilities
Developing and maintaining full-stack PHP/WordPress solutions using the Roots ecosystem (Bedrock, Acorn, Sage)
Building and supporting custom plugins and themes
Developing and maintaining ACF Gutenberg Blocks
Implementing pixel-perfect, responsive layouts using Blade, SCSS, and JavaScript
Designing and integrating REST APIs and third-party services…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, php, html, laravel, rest…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Europe. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptphphtmllaravelrestmysqlbedrockgitgitlab