K
KlaviyoEngineering

Lead Software Engineer, Reliability

Dublinonsitesenior

via Greenhouse

About this role

At Klaviyo, we value the unique backgrounds, experiences and perspectives each Klaviyo (we call ourselves Klaviyos) brings to our workplace each and every day. We believe everyone deserves a fair shot at success and appreciate the experiences each person brings beyond the traditional job requirements. If you’re a close but not exact match with the description, we hope you’ll still consider applying. Want to learn more about life at Klaviyo? Visit klaviyo.com/careers to see how we empower creators to own their own destiny. Lead Software Engineer, Reliability (Dublin) Team Overview As a Lead Software Engineer, Reliability, you will set technical direction and lead reliability strategy for Klaviyo’s most critical platforms.…

Read the full description on Klaviyo's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, go, react, django, fastapi…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Dublin. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythongoreactdjangofastapimysqlredismemcachedawskubernetesterraformkafkapulsarrabbitmqteamsklaviyo

More at Klaviyo

See all open jobs at Klaviyo