Staff Software Engineer (Hybrid)
Clearwateronsitestaff
via Greenhouse
About this role
KnowBe4 empowers the modern workforce to make smarter security decisions every day. Trusted by more than 70,000 organizations worldwide, KnowBe4 is the pioneer of digital workforce security, securing both AI agents and humans. The KnowBe4 Platform provides attack simulation and training, collaboration security, and agent security powered by AIDA (Artificial Intelligence Defense Agents) and a proprietary Risk Score. The platform leverages 15-years of behavioral data to combat advanced threats including social engineering, prompt injection, and shadow AI. By securing humans and agents, KnowBe4 leads the industry in workforce trust and defense.
We are seeking a Staff Software Engineer to join the KSAT Architecture Team — the engineering powerhouse behind our core product.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, ruby, react, vue, svelte…
2
Level fit
This role is staff-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Clearwater. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptrubyreactvuesveltesveltekittailwindviterailsgraphqlpostgrespostgresqlmysqldynamodbredisawss3lambdafargatesqsterraformserverlessgitlabsoc 2
More at Knowbe
- View →Customer Success Manager (Tech Touch)São Paulo, Brazil
- View →Customer Success Manager (Enterprise) (Fluent in Japanese) (Position located in Tokyo, Japan)Tokyo, Japan
- View →Regional Account Executive - SMB/MM (LATAM) (Portuguese Speaking) (Remote)São Paulo, Brazil
- View →Tech Support Coordinator (Hybrid)São Paulo, Brazil
- View →Account Executive (ENT) (Position located in Melbourne, Australia)Melbourne, Victoria, Australia
- View →Customer Success Manager (Mid Market) (Fluent in German) (Position located in Berlin, Germany)Berlin, Germany
