Software Engineer III - Web Development
Georgetownonsitemid
Posted 2w ago · via Smartrecruiters
About this role
Job Title: Engineer III, Software/Web Development FLSA Status: Exempt Department: Engineering Reports to: Principle Software Engineer, Software Engineering GENERAL DESCRIPTION / PURPOSE: The Engineer III, Software/Web development position is responsible for the design and development of innovative software and web solutions in a challenging hi tech engineering environment. ESSENTIAL JOB FUNCTIONS: Analysis Analyzes software and data requirements to determine feasibility of design within time and cost constraints. Consults with engineers, data analysists and other IT specialists to determine system specifications to meet the functional and performance requirements.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: c#, sql, react, tanstack, tailwindcss…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Georgetown. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
c#sqlreacttanstacktailwindcssasp.net.netdynamodbawss3ec2lambdasqsclaudeteams
More at Loram
- View →Help Desk Technician IIHamel, MN, United States
- View →Manager, HRIS & PayrollHamel, Minnesota, United States
- View →Total Rewards AnalystHamel, MN, United States
- View →Total Rewards AnalystHamel, Minnesota, United States
- View →Commercial DriverHamel, Minnesota, United States
- View →Service Technician-CDLAmarillo, Texas, United States
