L
LoramEngineering

Software Engineer III - Web Development

Georgetownonsitemid

Posted 2w ago · via Smartrecruiters

About this role

Job Title: Engineer III, Software/Web Development FLSA Status: Exempt Department: Engineering Reports to: Principle Software Engineer, Software Engineering GENERAL DESCRIPTION / PURPOSE: The Engineer III, Software/Web development position is responsible for the design and development of innovative software and web solutions in a challenging hi tech engineering environment. ESSENTIAL JOB FUNCTIONS: Analysis Analyzes software and data requirements to determine feasibility of design within time and cost constraints. Consults with engineers, data analysists and other IT specialists to determine system specifications to meet the functional and performance requirements.…

Read the full description on Loram's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: c#, sql, react, tanstack, tailwindcss…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Georgetown. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

c#sqlreacttanstacktailwindcssasp.net.netdynamodbawss3ec2lambdasqsclaudeteams

More at Loram

See all open jobs at Loram