Founding Backend Engineer
remotemid
via Ashby
About this role
Matchii is the new way to hire agencies: matched, not browsed.
Hiring an agency today is a slog: 20+ quotes, 40+ hours of vetting, and a gut-feel pick that's wrong about half the time. Matchii makes it feel like booking the perfect flight; describe what you need, the right team appears, work begins. Human, AI-native, or hybrid. We match. We back the outcome. Behind the scenes, it's two products on one platform: a matched marketplace for the people doing the hiring and an operating system that the agencies run their whole business on. Underneath both is a data layer, the largest dataset of real services pricing and outcomes anywhere, that makes every match smarter than the last. The timing is the whole point.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, python, java, go, sql…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptpythonjavagosqlnext.jspostgresqlrediskinesiskuberneteshelmsentrygrafanaprometheuslokiopentelemetryelksparkkafkaflinkmetabase
