Founding Backend Engineer

remotemid

via Ashby

About this role

Matchii is the new way to hire agencies: matched, not browsed. Hiring an agency today is a slog: 20+ quotes, 40+ hours of vetting, and a gut-feel pick that's wrong about half the time. Matchii makes it feel like booking the perfect flight; describe what you need, the right team appears, work begins. Human, AI-native, or hybrid. We match. We back the outcome. Behind the scenes, it's two products on one platform: a matched marketplace for the people doing the hiring and an operating system that the agencies run their whole business on. Underneath both is a data layer, the largest dataset of real services pricing and outcomes anywhere, that makes every match smarter than the last. The timing is the whole point.…

Read the full description on Matchii's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, python, java, go, sql…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptpythonjavagosqlnext.jspostgresqlrediskinesiskuberneteshelmsentrygrafanaprometheuslokiopentelemetryelksparkkafkaflinkmetabase

More at Matchii

See all open jobs at Matchii