Director, AI, Data and Developer Enablement
Grand Rapidshybriddirector
Posted today · via Workday
About this role
As a family company, we serve people and communities. When you work at Meijer, you’re provided with career and community opportunities centered around leadership, personal growth and development. Consider joining our family – take care of your career and your community! Meijer Rewards Weekly pay Scheduling flexibility Paid parental leave Paid education assistance Team member discount Development programs for advancement and career growth Please review the job profile below and apply today! Position will follow our hybrid schedule: Monday-Wednesday in Grand Rapids MI Corporate office, Thursday-Friday remote.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, scala, spark, kafka…
2
Level fit
This role is director-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Grand Rapids. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavascalasparkkafkascikit-learnpytorchtensorflowteams
More at Meijer
- View →Promotional Print Program ManagerGrand Rapids, MI
- View →Spclst, Discoverability ContentGrand Rapids, MI
- View →Mechanic, MasterNewport, MI 48166 - Distribution Complex Swan Creek Rd
- View →Drugstore, Pets, Consumables Sourcing ManagerGrand Rapids, MI
- View →Gas Station Team Leader Full TimeMarion, OH
- View →Registered Pharmacy TechMarion, OH
