Data Engineer

MetroParkonsitemid$88K – $105K

Posted 2 days ago · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Join Mizuho as a Data Engineer! The IT Data team is responsible for design and development of Data products for the entire firm. The team is embarking on an ambitious new project/implementation. “DEAL”. It is the abbreviation for "Data Exchange and Abstraction Layer". It’s the next generation, Data Mesh based platform implemented in the Mizuho Azure Cloud on Databricks. Data Mesh is a decentralized data architecture where data is owned and managed by the domain-specific teams that produce the data i.e. Banking, Finance etc., and curate it for downstream consumption. It emphasizes domain-oriented ownership, treating data as a product, providing a self-serve data platform, and using limited federated computational governance from the Data Architecture and Data Management Office.…

Read the full description on Mizuho's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, scala, sql, databricks, aws…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in MetroPark. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonscalasqldatabricksawsazuregcpsparkpysparkkafkagitteams

More at Mizuho

See all open jobs at Mizuho →