Member of Technical Staff - Product (Growth)
$150K – $300K
via Ashby
About this role
ABOUT US:
AI needs a new infrastructure layer. We're building it at Modal.
Every era of computing brought new workloads that previous infrastructure couldn't support: mainframes, databases, and the cloud. Each time, the company that rebuilt the layer underneath defined the decade. AI is no different, except it touches everything instead of one slice, and the window to build the layer underneath it is open right now.
Our customers include category-defining companies like Lovable https://modal.com/blog/lovable-case-study, Ramp https://modal.com/blog/how-ramp-built-a-full-context-background-coding-agent-on-modal, Cognition, DoorDash, and Suno.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, sveltekit, tailwind, vite, snowflake…
2
Level fit
We check your title trajectory against the seniority signal of the role.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in a specific location. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptsveltekittailwindvitesnowflakesentrysegmentmodalteamsposthog
