Digital Analytics Specialist

New Cairo Cityonsitemid

Posted 1mo ago · via Workable

See if I'm a fit →Tailor my resume for this role →Apply on Workable ↗

About this role

The Digital Analytics Implementation Specialist will focus on the technical implementation, maintenance, and debugging of tracking and analytics tools to ensure seamless data collection, integration, and analysis across web and mobile platforms. You will collaborate with cross-functional teams to enable efficient tracking, accurate reporting, and actionable insights, leveraging tools like Clevertap, Appsflyer, Adjust, Mixpanel, and GA4, along with Amazon Redshift and QuickSight for advanced analytics. You are also expected to leverage modern AI-powered tools to enhance productivity, improve debugging efficiency, and support data analysis, while ensuring responsible and secure usage .…

Read the full description on Mondia Group's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, sql, html, css, redshift…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in New Cairo City. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptsqlhtmlcssredshiftteamsandroid studiogdprmixpanel

More at Mondia Group

See all open jobs at Mondia Group →