Cash Management Lead Software Developer, Vice President
Jersey Cityonsitevp$140K – $205K
Posted today · via Workday
About this role
Do you want your voice heard and your actions to count? Discover your opportunity with Mitsubishi UFJ Financial Group (MUFG), one of the world’s leading financial groups. Across the globe, we’re 150,000 colleagues, striving to make a difference for every client, organization, and community we serve. We stand for our values, building long-term relationships, serving society, and fostering shared and sustainable growth for a better world. With a vision to be the world’s most trusted financial group, it’s part of our culture to put people first, listen to new and diverse ideas and collaborate toward greater innovation, speed and agility. This means investing in talent, technologies, and tools that empower you to own your career.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, javascript, python, java, swift…
2
Level fit
This role is vp-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Jersey City. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptjavascriptpythonjavaswiftshellsqlhtmlcssreactangularspringspring bootresthibernateawsazuregoogle clouds3lambdakubernetesdockerterraformjenkins
More at MUFG Bank
- View →Vice President Credit OfficerMUFG Global Service Private Ltd. - Mumbai (NKP)
- View →Vice President, Regional Product Manager - Transaction Banking for APACSingapore Office Marina One
- View →AVP/VP GHR Ops SupportMUFG Global Service Private Ltd. - Bengaluru (BCIT)
- View →Analyst, Sales Support - Global MarketsSydney Branch
- View →AVP/VP GHR Ops SupportMUFG Global Service Private Ltd. - Bengaluru (BCIT)
- View →Associate / AVP, Supporting Relationship Manager - Corporate Coverage BeNeLuxAmsterdam
