M
MySigridCustomer Success

Senior WordPress Developer - Remote/Hybrid Role (US client)

Manilaonsitesenior

Posted 1w ago · via Workable

About this role

Role Overview: Senior WordPress Developer We are looking for an experienced Senior WordPress Developer to build, customize, and maintain secure, high-performing websites. The role focuses on WordPress development, GoHighLevel integrations, custom themes/plugins, troubleshooting, performance optimization, and delivering reliable technical solutions while collaborating with clients and teams.…

Read the full description on MySigrid's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, html, css, mysql…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Manila. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphphtmlcssmysqlgitteams

More at MySigrid

See all open jobs at MySigrid