Agentic Product Engineer | Mid - Senior | Full-stack | Saily
senior$324K – $450K
via Ashby
About this role
At Saily, we’re removing the hassle of staying connected while traveling — no roaming fees, no plastic SIM cards, just lightning-fast, secure mobile data in 200+ destinations. Saily has millions of paying customers and hundreds of thousands travelers browsing through Saily at any given moment.
To build the best product for our customers we foster AI-native Product Engineering culture, where:
- The Engineer is the builder, who is responsible for solving customer problems end-to-end (idea to production)
- AI Agents are the enablers who write most of the code and solve repeatable tasks to help the Engineers maximize their impact
- Everyone contributes to making Saily effective by suggesting new areas for improvement to delegate to agents and then implementing the changes…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, go, kotlin, css, next.js…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in a specific location. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptgokotlincssnext.jstailwindgraphqlmysqlredisawscloudflarekubernetesdockerkafkaopenaiclaudeteamsxcodeandroid studio
More at Nord-security
- View →Staff Site Reliability Engineer - Platform Engineering | NordVPN
- View →Systems Administrator | macOS/iOS | Mid-Senior
- View →Sales Operations Specialist | B2B
- View →Influencer Marketing Manager | Saily | Mid-Senior
- View →Employer Brand Manager | Junior-Mid | Warsaw
- View →Manual QA Engineer I Mid-senior I NordVPN Windows
