N
Novakid SchoolEngineering / IT

Principal Backend Engineer (Architect Track) - Remote

Beogradremoteprincipal

Posted 3mo ago · via Recruitee

About this role

Novakid is an online English platform for kids — 100,000+ students, 2,500+ teachers, 15+ countries. Live classes run around the clock across time zones, which sets the technical bar: low latency, high availability, and a backend that holds up at real scale. We’ve built a working platform. The next chapter is making deliberate architectural choices about how it should evolve. The role We’re hiring a Principal Backend Engineer to take ownership of backend architecture as a hands-on technical leader. No direct reports. About half your time is in the code — reference implementations, critical components, refactors. The other half is the harder work: deciding what to build, what to buy, what to defer, and why.…

Read the full description on Novakid School's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, fastapi, postgres, redis, rds…

2

Level fit

This role is principal-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonfastapipostgresredisrdssqlalchemyawsgcplambdaekskubernetesopenaianthropicclaudeteams

More at Novakid School

See all open jobs at Novakid School