N
NowInformation Technology

Cassandra DBA

Dallasremote$10K$15K

Posted 43mo ago · via Smartrecruiters

About this role

About Now100 is committed to understanding our clients’ needs and providing solutions that not only meet but exceed their expectations. We match thoroughly vetted resources to contract, contract-to-hire, and permanent positions in all industries. We are looking for a Cassandra DBA for one of our clients here in Atlanta, GA or Dallas, TX. Please find the position details below and let me know your interest in this. Role: DBA - Cassandra Duration: 6+ Months Location: Atlanta, GA / Dallas, TX (Remote) No of positions: 2 Required 5-7+ years of working experience in Design, Build, Maintenance, and Administration of NoSQL distributed database systems like Datastax Cassandra and good experience on Legacy Databases like PostgreSQL, MySQL, IBM DB2 UDB, Oracle DB, Graph DBs, etc.…

Read the full description on Now's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: sql, postgresql, mysql, cassandra, spanner…

2

Level fit

We check your title trajectory against the seniority signal of the role.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

sqlpostgresqlmysqlcassandraspannerawsazuregcpgoogle cloudterraformansiblechef

More at Now

See all open jobs at Now