O
OCBCMGR/AVP, AI and Data Analyst
OCBC Singaporehybridmanager
Posted today · via Workday
About this role
WHO WE ARE: As Singapore’s longest established bank, we have been dedicated to enabling individuals and businesses to achieve their aspirations since 1932. How? By taking the time to truly understand people. From there, we provide support, services, solutions, and career paths that meet their individual needs and desires. Today, we’re on a journey of transformation. Leveraging technology and creativity to become a future-ready learning organisation. But for all that change, our strategic ambition is consistently clear and bold, which is to be Asia’s leading financial services partner for a sustainable future. We invite you to build the bank of the future. Innovate the way we deliver financial services. Work in friendly, supportive teams. Build lasting value in your community.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, redshift, aws, athena…
2
Level fit
This role is manager-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in OCBC Singapore. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlredshiftawsathenasagemakerjenkinspower bibedrockbitbucketteams
More at OCBC
- View →Business Manager, Sales Strategy and Management for Global South Asia & International (Vice President)BOS Singapore
- View →Assistant Manager, Settlement & Custody Services (Transaction Management)OCBC Hong Kong
- View →Client Account Services Manager, Maintenance (Manager/ AVP)BOS Singapore
- View →Assistant Manager, Business Service CentreOCBC Hong Kong
- View →AML & Sanctions Risk Team MemberOCBC Singapore
- View →CDD CheckerOCBC China, Shanghai
