Senior Design System Designer
Hong Kongonsitesenior
via Greenhouse
About this role
OKX will be prioritising applicants who have a current right to work in Hong Kong, and do not require OKX's sponsorship of a visa.
Who We Are
At OKX, we believe that the future will be reshaped by crypto, and ultimately contribute to every individual's freedom. OKX is a leading crypto exchange, and the developer of OKX Wallet, giving millions access to crypto trading and decentralized crypto applications (dApps). OKX is also a trusted brand by hundreds of large institutions seeking access to crypto markets. We are safe and reliable, backed by our Proof of Reserves. Across our multiple offices globally, we are united by our core principles: We Before Me, Do the Right Thing, and Get Things Done.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, html, css, react, figma…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Hong Kong. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascripthtmlcssreactfigmasketchadobe xdteams
More at Okx
- View →Arabic Language Manager - MENA RemoteDubai, United Arab Emirates
- View →Android DeveloperSingapore, Singapore
- View →Administrative Manager, Travel ManagementHong Kong, Hong Kong SAR
- View →Director of Communications, AmericasNew York, United States; San Francisco, California, United States
- View →Head of Communications and PR, APACHong Kong, Hong Kong SAR
- View →AI Native Platform ArchitectHong Kong, Hong Kong SAR
