Salesforce Marketing Cloud Technical Lead

Madridonsitesenior

Posted 2w ago · via Teamtailor

About this role

Omega CRM is a Merkle & Dentsu company, leader in development of Customer Experience services, with +20 years of experience in the use of Technology applied to Marketing and providing a unique Customer Relationship with mainly focus on Innovation is looking for a Salesforce Marketing Cloud Technical Lead. The Technical Lead in Omega’s Marketing team is responsible for ensuring the technical progress of the project, advising all technical roles involved throughout the various stages, and ensuring that the development team works to meet both client and company expectations regarding technical quality and project profitability. This includes identifying potential gaps and advising on the best solutions.…

Read the full description on Omega CRM's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, sql, html, css, teams…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Madrid. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptsqlhtmlcssteamssalesforce

More at Omega CRM

See all open jobs at Omega CRM