Senior Data Scientist
United States-RemoteRemote (US)senior$140K – $190K
via Greenhouse
About this role
At OneStudyTeam (a Reify Health company), we specialize in speeding up clinical trials and increasing the chance of new therapies being approved with the ultimate goal of improving patient outcomes. Our cloud-based platform, StudyTeam, brings research site workflows online and enables sites, sponsors, and other key stakeholders to work together more effectively. StudyTeam is trusted by the largest global biopharmaceutical companies, used in over 6,000 research sites, and is available in over 100 countries. Join us in our mission to advance clinical research and improve patient care.
One mission. One team. That’s OneStudyTeam.
As a Senior Data Scientist, you will play a pivotal role in advancing Reify Health’s data-driven solutions for clinical trials.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, redshift, aws, athena…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlredshiftawsathenasagemakerdbtscikit-learnteamsgdprhipaa
More at Onestudyteam
- View →Product Operations LeadUnited States-Remote
- View →Senior Director of EngineeringUnited States-Remote
- View →Senior Security Compliance AnalystUnited States-Remote
- View →Salesforce Administrator/DeveloperIndia-Remote
- View →Senior Machine Learning EngineerUnited States-Remote
- View →Director, Sales Strategy & ValueUnited States-Remote
