reqspace
Start free trial →
O
Oumedicine

Web Specialist

Oklahoma Cityonsitemid

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Position Title: Web Specialist Department: Brand and Growth Marketing Job Description: New to OU Health? Ask your recruiter about our competitive wages and total rewards package! General Description: The Web Specialist of Patient Acquisition Strategy is a hands-on technical expert responsible for developing, maintaining, and optimizing OU Health’s web and marketing technology infrastructure. This role supports the Mgr Patient Acquisition & Consumer Engagement in building a seamless digital ecosystem that powers patient acquisition, engagement, and conversion. As part of the insourced web team, the Strategist will serve as OU Health’s primary developer and martech integrator, ensuring all systems—from CMS to CRM—work together to support measurable digital growth.…

Read the full description on Oumedicine's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, sql, html, css…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Oklahoma City. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphpsqlhtmlcssteamssalesforce

More at Oumedicine

See all open jobs at Oumedicine →